Sermorelin — 20mg Box
Sermorelin — 20mg Box contains 2 × 10mg vials, providing a total quantity of 20mg per box. Each vial contains 10mg of Sermorelin research material. The product is supplied with clearly identified CAS information, molecular specifications, packaging details, purity information, and research-use labeling. Intended for laboratory research use only and not for human or veterinary use.
Product Details
| Specification | Details |
|---|---|
| Product Name | Sermorelin — 20mg Box |
| Compound | Sermorelin |
| Total Quantity | 20mg |
| Packaging | 2 × 10mg vials |
| Amount per Vial | 10mg |
| CAS Number | 86168-78-7 |
| Molecular Formula | C₁₄₉H₂₄₆N₄₄O₄₂S |
| Molecular Weight | 3357.9 g/mol |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ |
| Product Type | Synthetic Peptide |
| Purity | 99% HPLC* |
| Use | Research Use Only |
| Human/Veterinary Use | Not for human or veterinary use |
PubChem lists Sermorelin as CAS 86168-78-7, formula C149H246N44O42S, and molecular weight 3357.9 g/mol. Note that sermorelin acetate is a separate salt with a different CAS/formula, so the exact supplier form should be matched to the COA.
Reviews
There are no reviews yet.